rmarkdown - Dynamic Documents for R
Convert R Markdown documents into a variety of formats.
Last updated
literate-programmingmarkdownpandocrmarkdown
22.06 score 3.0k stars 4.2k dependents 18k scripts 1.5M downloads
shiny - Web Application Framework for R
Makes it incredibly easy to build interactive web applications with R. Automatic "reactive" binding between inputs and outputs and extensive prebuilt widgets make it possible to build beautiful, responsive, and powerful applications with minimal effort.
Last updated
reactiverstudioshinyweb-appweb-development
21.86 score 5.7k stars 2.0k dependents 146k scripts 968k downloadsreticulate - Interface to 'Python'
Interface to 'Python' modules, classes, and functions. When calling into 'Python', R data types are automatically converted to their equivalent 'Python' types. When values are returned from 'Python' to R they are converted back to R types. Compatible with all versions of 'Python' >= 2.7.
Last updated
cpp
21.03 score 1.8k stars 554 dependents 29k scripts 173k downloadsDT - A Wrapper of the JavaScript Library 'DataTables'
Data objects in R can be rendered as HTML tables using the JavaScript library 'DataTables' (typically via R Markdown or Shiny). The 'DataTables' library has been included in this R package. The package name 'DT' is an abbreviation of 'DataTables'.
Last updated
datatableshtmlwidgetsjavascriptshiny
19.34 score 619 stars 752 dependents 53k scripts 542k downloads
rstudioapi - Safely Access the RStudio API
Access the RStudio API (if available) and provide informative error messages when it's not.
Last updated
19.09 score 174 stars 2.2k dependents 5.6k scripts 800k downloads
renv - Project Environments
A dependency management toolkit for R. Using 'renv', you can create and manage project-local R libraries, save the state of these libraries to a 'lockfile', and later restore your library as required. Together, these tools can help make your projects more isolated, portable, and reproducible.
Last updated
18.91 score 1.2k stars 139 dependents 3.4k scripts 304k downloads
bslib - Custom 'Bootstrap' 'Sass' Themes for 'shiny' and 'rmarkdown'
Simplifies custom 'CSS' styling of both 'shiny' and 'rmarkdown' via 'Bootstrap' 'Sass'. Supports 'Bootstrap' 3, 4 and 5 as well as their various 'Bootswatch' themes. An interactive widget is also provided for previewing themes in real time.
Last updated
bootstraphtmltoolsrmarkdownsassshiny
18.64 score 564 stars 4.9k dependents 13k scripts 1.6M downloads
promises - Abstractions for Promise-Based Asynchronous Programming
Provides fundamental abstractions for doing asynchronous programming in R using promises. Asynchronous programming is useful for allowing a single R process to orchestrate multiple tasks in the background while also attending to something else. Semantics are similar to 'JavaScript' promises, but with a syntax that is idiomatic R.
Last updated
promises
18.44 score 210 stars 2.9k dependents 1.8k scripts 837k downloads
gt - Easily Create Presentation-Ready Display Tables
Build display tables from tabular data with an easy-to-use set of functions. With its progressive approach, we can construct display tables with a cohesive set of table parts. Table values can be formatted using any of the included formatting functions. Footnotes and cell styles can be precisely added through a location targeting system. The way in which 'gt' handles things for you means that you don't often have to worry about the fine details.
Last updated
docxeasy-to-usehtmllatexrtfsummary-tables
18.39 score 2.1k stars 197 dependents 32k scripts 138k downloadstinytex - Helper Functions to Install and Maintain TeX Live, and Compile LaTeX Documents
Helper functions to install and maintain the 'LaTeX' distribution named 'TinyTeX' (<https://yihui.org/tinytex/>), a lightweight, cross-platform, portable, and easy-to-maintain version of 'TeX Live'. This package also contains helper functions to compile 'LaTeX' documents, and install missing 'LaTeX' packages automatically.
Last updated
latextexlive
18.22 score 1.1k stars 4.2k dependents 4.0k scripts 1.1M downloads
htmltools - Tools for HTML
Tools for HTML generation and output.
Last updated
17.94 score 222 stars 5.0k dependents 15k scripts 1.3M downloads
bookdown - Authoring Books and Technical Documents with R Markdown
Output formats and utilities for authoring books and technical documents with R Markdown.
Last updated
bookbookdownepubgitbookhtmllatexrmarkdown
17.83 score 4.1k stars 128 dependents 2.1k scripts 91k downloadsleaflet - Create Interactive Web Maps with the JavaScript 'Leaflet' Library
Create and customize interactive maps using the 'Leaflet' JavaScript library and the 'htmlwidgets' package. These maps can be used directly from the R console, from 'RStudio', in Shiny applications and R Markdown documents.
Last updated
gisleaflet-mapspatial
17.19 score 839 stars 208 dependents 45k scripts 172k downloadshttpuv - HTTP and WebSocket Server Library
Provides low-level socket and protocol support for handling HTTP and WebSocket requests directly from within R. It is primarily intended as a building block for other packages, rather than making it particularly easy to create complete web applications using httpuv alone. httpuv is built on top of the libuv and http-parser C libraries, both of which were developed by Joyent, Inc. (See LICENSE file for libuv and http-parser license information.)
Last updated
libuv1cpp
16.26 score 250 stars 2.2k dependents 1.3k scripts 860k downloads
sass - Syntactically Awesome Style Sheets ('Sass')
An 'SCSS' compiler, powered by the 'LibSass' library. With this, R developers can use variables, inheritance, and functions to generate dynamic style sheets. The package uses the 'Sass CSS' extension language, which is stable, powerful, and CSS compatible.
Last updated
cpp
16.13 score 102 stars 4.9k dependents 836 scripts 1.5M downloads
fontawesome - Easily Work with 'Font Awesome' Icons
Easily and flexibly insert 'Font Awesome' icons into 'R Markdown' documents and 'Shiny' apps. These icons can be inserted into HTML content through inline 'SVG' tags or 'i' tags. There is also a utility function for exporting 'Font Awesome' icons as 'PNG' images for those situations where raster graphics are needed.
Last updated
font-awesomesvg-icons
16.00 score 301 stars 4.8k dependents 5.5k scripts 1.0M downloadsshinydashboard - Create Dashboards with 'Shiny'
Create dashboards with 'Shiny'. This package provides a theme on top of 'Shiny', making it easy to create attractive dashboards.
Last updated
admin-dashboarddashboardreactivityrstudioshinyshinydashboardweb-appweb-development
15.56 score 927 stars 218 dependents 20k scripts 55k downloads
rsconnect - Deploy Docs, Apps, and APIs to 'Posit Connect', 'shinyapps.io', and 'RPubs'
Programmatic deployment interface for 'RPubs', 'shinyapps.io', and 'Posit Connect'. Supported content types include R Markdown documents, Shiny applications, Plumber APIs, plots, and static web content.
Last updated
posit-connect
15.25 score 145 stars 3 dependents 5.2k scripts 72k downloadscrosstalk - Inter-Widget Interactivity for HTML Widgets
Provides building blocks for allowing HTML widgets to communicate with each other, with Shiny or without (i.e. static .html files). Currently supports linked brushing and filtering.
Last updated
15.02 score 297 stars 1.7k dependents 2.6k scripts 506k downloads
learnr - Interactive Tutorials for R
Create interactive tutorials using R Markdown. Use a combination of narrative, figures, videos, exercises, and quizzes to create self-paced tutorials for learning about R and R packages.
Last updated
interactivepythonrmarkdownshinysqlteachingtutorial
14.91 score 734 stars 49 dependents 9.3k scripts 18k downloadsdygraphs - Interface to 'Dygraphs' Interactive Time Series Charting Library
An R interface to the 'dygraphs' JavaScript charting library (a copy of which is included in the package). Provides rich facilities for charting time-series data in R, including highly configurable series- and axis-display and interactive features like zoom/pan and series/point highlighting.
Last updated
14.71 score 366 stars 67 dependents 8.5k scripts 256k downloadskeras3 - R Interface to 'Keras'
Interface to 'Keras' <https://keras.io>, a high-level neural networks API. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both CPU and GPU devices.
Last updated
14.64 score 853 stars 6 dependents 1.3k scripts 8.2k downloads
pins - Pin, Discover, and Share Resources
Publish data sets, models, and other R objects, making it easy to share them across projects and with your colleagues. You can pin objects to a variety of "boards", including local folders (to share on a networked drive or with 'DropBox'), 'Posit Connect', 'AWS S3', and more.
Last updated
azuregcloudrpinsrsconnects3storage
14.63 score 334 stars 31 dependents 1.8k scripts 7.2k downloads
config - Manage Environment Specific Configuration Values
Manage configuration values across multiple environments (e.g. development, test, production). Read values using a function that determines the current environment and returns the appropriate value.
Last updated
14.52 score 263 stars 228 dependents 3.7k scripts 47k downloadsshinythemes - Themes for Shiny
Themes for use with Shiny. Includes several Bootstrap themes from <https://bootswatch.com/>, which are packaged for use with Shiny applications.
Last updated
14.35 score 160 stars 130 dependents 9.3k scripts 429k downloads
plumber - An API Generator for R
Gives the ability to automatically generate and serve an HTTP API from R functions using the annotations in the R documentation around your functions.
Last updated
apiapi-serverplumber
14.30 score 1.4k stars 19 dependents 3.5k scripts 64k downloadsmarkdown - A thin wrapper of 'litedown' to render Markdown documents
Render Markdown to HTML/LaTeX. This package has been superseded by 'litedown'. Please call 'litedown::mark()' directly.
Last updated
commonmarkmarkdown
14.25 score 88 stars 577 dependents 4.5k scripts 352k downloads
flexdashboard - R Markdown Format for Flexible Dashboards
Format for converting an R Markdown document to a grid oriented dashboard. The dashboard flexibly adapts the size of it's components to the containing web page.
Last updated
13.71 score 844 stars 8 dependents 10k scripts 15k downloadsminiUI - Shiny UI Widgets for Small Screens
Provides UI widget and layout functions for writing Shiny apps that work well on small screens.
Last updated
13.53 score 108 stars 529 dependents 629 scripts 633k downloads
chromote - Headless Chrome Web Browser Interface
An implementation of the 'Chrome DevTools Protocol', for controlling a headless Chrome web browser.
Last updated
13.45 score 178 stars 38 dependents 289 scripts 61k downloadspackrat - A Dependency Management System for Projects and their R Package Dependencies
Manage the R packages your project depends on in an isolated, portable, and reproducible way.
Last updated
13.16 score 408 stars 7 dependents 294 scripts 50k downloadspool - Object Pooling
Enables the creation of object pools, which make it less computationally expensive to fetch a new object. Currently the only supported pooled objects are 'DBI' connections.
Last updated
13.13 score 255 stars 34 dependents 964 scripts 21k downloads
shinytest2 - Testing for Shiny Applications
Automated unit testing of Shiny applications through a headless 'Chromium' browser.
Last updated
cpp
12.41 score 121 stars 1.2k scripts 20k downloads
pagedown - Paginate the HTML Output of R Markdown with CSS for Print
Use the paged media properties in CSS and the JavaScript library 'paged.js' to split the content of an HTML document into discrete pages. Each page can have its page size, page numbers, margin boxes, and running headers, etc. Applications of this package include books, letters, reports, papers, business cards, resumes, and posters.
Last updated
csshtmlpaged-mediapdfprintingtypesetting
12.36 score 926 stars 17 dependents 616 scripts 19k downloadsr2d3 - Interface to 'D3' Visualizations
Suite of tools for using 'D3', a library for producing dynamic, interactive data visualizations. Supports translating objects into 'D3' friendly data structures, rendering 'D3' scripts, publishing 'D3' visualizations, incorporating 'D3' in R Markdown, creating interactive 'D3' applications with Shiny, and distributing 'D3' based 'htmlwidgets' in R packages.
Last updated
d3r2d3visualization
12.30 score 525 stars 11 dependents 582 scripts 6.0k downloads
sortable - Drag-and-Drop in 'shiny' Apps with 'SortableJS'
Enables drag-and-drop behaviour in Shiny apps, by exposing the functionality of the 'SortableJS' <https://sortablejs.github.io/Sortable/> JavaScript library as an 'htmlwidget'. You can use this in Shiny apps and widgets, 'learnr' tutorials as well as R Markdown. In addition, provides a custom 'learnr' question type - 'question_rank()' - that allows ranking questions with drag-and-drop.
Last updated
htmlwidget
12.24 score 136 stars 29 dependents 397 scripts 5.9k downloadstfruns - Training Run Tools for 'TensorFlow'
Create and manage unique directories for each 'TensorFlow' training run. Provides a unique, time stamped directory for each run along with functions to retrieve the directory of the latest run or latest several runs.
Last updated
11.90 score 34 stars 78 dependents 394 scripts 17k downloadsleaflet.providers - Leaflet Providers
Contains third-party map tile provider information from 'Leaflet.js', <https://github.com/leaflet-extras/leaflet-providers>, to be used with the 'leaflet' R package. Additionally, 'leaflet.providers' enables users to retrieve up-to-date provider information between package updates.
Last updated
11.78 score 15 stars 209 dependents 510 scripts 63k downloads
rticles - Article Formats for R Markdown
A suite of custom R Markdown formats and templates for authoring journal articles and conference submissions.
Last updated
articlejournalpaperrmarkdown
11.75 score 1.5k stars 3 dependents 163 scripts 11k downloads
websocket - 'WebSocket' Client Library
Provides a 'WebSocket' client interface for R. 'WebSocket' is a protocol for low-overhead real-time communication: <https://en.wikipedia.org/wiki/WebSocket>.
Last updated
opensslcpp
11.55 score 93 stars 65 dependents 75 scripts 66k downloads
pointblank - Data Validation and Organization of Metadata for Local and Remote Tables
Validate data in data frames, 'tibble' objects, 'Spark' 'DataFrames', and database tables. Validation pipelines can be made using easily-readable, consecutive validation steps. Upon execution of the validation plan, several reporting options are available. User-defined thresholds for failure rates allow for the determination of appropriate reporting actions. Many other workflows are available including an information management workflow, where the aim is to record, collect, and generate useful information on data tables.
Last updated
data-assertionsdata-checkerdata-dictionariesdata-framesdata-inferencedata-managementdata-profilerdata-qualitydata-validationdata-verificationdatabase-tableseasy-to-understandreporting-toolschema-validationtesting-toolsyaml-configuration
11.35 score 1.0k stars 3 dependents 557 scripts 5.7k downloadstufte - Tufte's Styles for R Markdown Documents
Provides R Markdown output formats to use Tufte styles for PDF and HTML output.
Last updated
r-markdowntuftetufte-style
11.18 score 430 stars 2 dependents 1.6k scripts 9.9k downloads
blogdown - Create Blogs and Websites with R Markdown
Write blog posts and web pages in R Markdown. This package supports the static site generator 'Hugo' (<https://gohugo.io>) best, and it also supports 'Jekyll' (<https://jekyllrb.com>) and 'Hexo' (<https://hexo.io>).
Last updated
blog-engineblogdownhugormarkdownrstudiowebsite-generation
11.00 score 1.8k stars 1.6k scripts 1.7k downloadskeras - R Interface to 'Keras'
Interface to 'Keras' <https://keras.io>, a high-level neural networks 'API'. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both 'CPU' and 'GPU' devices.
Last updated
10.95 score 1 stars 53 dependents 15k scripts 16k downloadswebshot2 - Take Screenshots of Web Pages
Takes screenshots of web pages, including Shiny applications and R Markdown documents. 'webshot2' uses headless Chrome or Chromium as the browser back-end.
Last updated
10.85 score 126 stars 28 dependents 1.9k scripts 39k downloads
blastula - Easily Send HTML Email Messages
Compose and send out responsive HTML email messages that render perfectly across a range of email clients and device sizes. Helper functions let the user insert embedded images, web link buttons, and 'ggplot2' plot objects into the message body. Messages can be sent through an 'SMTP' server, through the 'Posit Connect' service, or through the 'Mailgun' API service <https://www.mailgun.com/>.
Last updated
easy-to-useemailhtmlmarkdownresponsive-emailsmtp
10.79 score 570 stars 7 dependents 694 scripts 8.6k downloads
thematic - Unified and Automatic 'Theming' of 'ggplot2', 'lattice', and 'base' R Graphics
Theme 'ggplot2', 'lattice', and 'base' graphics based on a few choices, including foreground color, background color, accent color, and font family. Fonts that aren't available on the system, but are available via download on 'Google Fonts', can be automatically downloaded, cached, and registered for use with the 'showtext' and 'ragg' packages.
Last updated
10.62 score 253 stars 3 dependents 1.1k scripts 16k downloads
distill - 'R Markdown' Format for Scientific and Technical Writing
Scientific and technical article format for the web. 'Distill' articles feature attractive, reader-friendly typography, flexible layout options for visualizations, and full support for footnotes and citations.
Last updated
10.08 score 425 stars 6 dependents 550 scripts 2.8k downloadstfdatasets - Interface to 'TensorFlow' Datasets
Interface to 'TensorFlow' Datasets, a high-level library for building complex input pipelines from simple, re-usable pieces. See <https://www.tensorflow.org/guide> for additional details.
Last updated
9.92 score 33 stars 3 dependents 1.1k scripts 4.8k downloads
gradethis - Automated Feedback for Student Exercises in 'learnr' Tutorials
Pairing with the 'learnr' R package, 'gradethis' provides multiple methods to grade 'learnr' exercises. To learn more about 'learnr' tutorials, please visit <https://rstudio.github.io/learnr/>.
Last updated
9.85 score 164 stars 6 dependents 2.0k scripts
vetiver - Version, Share, Deploy, and Monitor Models
The goal of 'vetiver' is to provide fluent tooling to version, share, deploy, and monitor a trained model. Functions handle both recording and checking the model's input data prototype, and predicting from a remote API endpoint. The 'vetiver' package is extensible, with generics that can support many kinds of models.
Last updated
9.81 score 198 stars 1 dependents 531 scripts 1.1k downloadsbsicons - Easily Work with 'Bootstrap' Icons
Easily use 'Bootstrap' icons inside 'Shiny' apps and 'R Markdown' documents. More generally, icons can be inserted in any 'htmltools' document through inline 'SVG'.
Last updated
9.49 score 17 stars 42 dependents 1.3k scripts 22k downloadsshinyvalidate - Input Validation for Shiny Apps
Improves the user experience of Shiny apps by helping to provide feedback when required inputs are missing, or input values are not valid.
Last updated
shinyuivalidation
9.40 score 115 stars 15 dependents 338 scripts 7.1k downloads
reactlog - Reactivity Visualizer for 'shiny'
Building interactive web applications with R is incredibly easy with 'shiny'. Behind the scenes, 'shiny' builds a reactive graph that can quickly become intertwined and difficult to debug. 'reactlog' (Schloerke 2019) <doi:10.5281/zenodo.2591517> provides a visual insight into that black box of 'shiny' reactivity by constructing a directed dependency graph of the application's reactive state at any time point in a reactive recording.
Last updated
9.23 score 131 stars 295 scripts 15k downloadsswagger - Dynamically Generates Documentation from a 'Swagger' Compliant API
A collection of 'HTML', 'JavaScript', and 'CSS' assets that dynamically generate beautiful documentation from a 'Swagger' compliant API: <https://swagger.io/specification/>.
Last updated
8.92 score 54 stars 22 dependents 17 scripts 23k downloadsshinytest - Test Shiny Apps
Please see the shinytest to shinytest2 migration guide at <https://rstudio.github.io/shinytest2/articles/z-migration.html>.
Last updated
8.82 score 224 stars 638 scripts 5.1k downloads
bigD - Flexibly Format Dates and Times to a Given Locale
Format dates and times flexibly and to whichever locales make sense. Parses dates, times, and date-times in various formats (including string-based ISO 8601 constructions). The formatting syntax gives the user many options for formatting the date and time output in a precise manner. Time zones in the input can be expressed in multiple ways and there are many options for formatting time zones in the output as well. Several of the provided helper functions allow for automatic generation of locale-aware formatting patterns based on date/time skeleton formats and standardized date/time formats with varying specificity.
Last updated
datedatetimeeasy-to-usei18ntime
8.79 score 20 stars 191 dependents 1 scripts 109k downloadsbundle - Serialize Model Objects with a Consistent Interface
Typically, models in 'R' exist in memory and can be saved via regular 'R' serialization. However, some models store information in locations that cannot be saved using 'R' serialization alone. The goal of 'bundle' is to provide a common interface to capture this information, situate it within a portable object, and restore it for use in new settings.
Last updated
8.74 score 31 stars 4 dependents 254 scripts 2.0k downloadscloudml - Interface to the Google Cloud Machine Learning Platform
Interface to the Google Cloud Machine Learning Platform <https://cloud.google.com/vertex-ai>, which provides cloud tools for training machine learning models.
Last updated
cloudmlgpcgpukerastensorflow
8.70 score 65 stars 172 scripts 648 downloadsshinymeta - Export Domain Logic from Shiny using Meta-Programming
Provides tools for capturing logic in a Shiny app and exposing it as code that can be run outside of Shiny (e.g., from an R console). It also provides tools for bundling both the code and results to the end user.
Last updated
8.68 score 227 stars 10 dependents 101 scripts 574 downloadstfprobability - Interface to 'TensorFlow Probability'
Interface to 'TensorFlow Probability', a 'Python' library built on 'TensorFlow' that makes it easy to combine probabilistic models and deep learning on modern hardware ('TPU', 'GPU'). 'TensorFlow Probability' includes a wide selection of probability distributions and bijectors, probabilistic layers, variational inference, Markov chain Monte Carlo, and optimizers such as Nelder-Mead, BFGS, and SGLD.
Last updated
8.67 score 57 stars 2 dependents 340 scripts 467 downloadsrevealjs - R Markdown Format for 'reveal.js' Presentations
R Markdown format for 'reveal.js' presentations, a framework for easily creating beautiful presentations using HTML.
Last updated
8.61 score 329 stars 1 dependents 149 scripts 4.0k downloadstfestimators - Interface to 'TensorFlow' Estimators
Interface to 'TensorFlow' Estimators <https://www.tensorflow.org/guide/estimator>, a high-level API that provides implementations of many different model types including linear models and deep neural networks.
Last updated
8.55 score 58 stars 228 scripts 870 downloads
juicyjuice - Inline CSS Properties into HTML Tags Using 'juice'
There are occasions where you need a piece of HTML with integrated styles. A prime example of this is HTML email. This transformation involves moving the CSS and associated formatting instructions from the style block in the head of your document into the body of the HTML. Many prominent email clients require integrated styles in HTML email; otherwise a received HTML email will be displayed without any styling. This package will quickly and precisely perform these CSS transformations when given HTML text and it does so by using the JavaScript 'juice' library.
Last updated
csshtmlinlining
7.98 score 3 stars 192 dependents 3 scripts 109k downloads
nomnoml - Sassy 'UML' Diagrams
A tool for drawing sassy 'UML' (Unified Modeling Language) diagrams based on a simple syntax, see <https://www.nomnoml.com>. Supports styling, R Markdown and exporting diagrams in the PNG format. Note: you need a chromium based browser installed on your system.
Last updated
diagramshtmlwidgetsnomnomluml
7.82 score 222 stars 3 dependents 132 scripts 575 downloadstfhub - Interface to 'TensorFlow' Hub
'TensorFlow' Hub is a library for the publication, discovery, and consumption of reusable parts of machine learning models. A module is a self-contained piece of a 'TensorFlow' graph, along with its weights and assets, that can be reused across different tasks in a process known as transfer learning. Transfer learning train a model with a smaller dataset, improve generalization, and speed up training.
Last updated
7.64 score 29 stars 1 dependents 111 scripts 278 downloadswebdriver - 'WebDriver' Client for 'PhantomJS'
A client for the 'WebDriver' 'API'. It allows driving a (probably headless) web browser, and can be used to test web applications, including 'Shiny' apps. In theory it works with any 'WebDriver' implementation, but it was only tested with 'PhantomJS'.
Last updated
7.49 score 72 stars 1 dependents 147 scripts 6.5k downloads
connections - Integrates with the 'RStudio' Connections Pane and 'pins'
Enables 'DBI' compliant packages to integrate with the 'RStudio' connections pane, and the 'pins' package. It automates the display of schemata, tables, views, as well as the preview of the table's top 1000 records.
Last updated
connection-panedatabase-connectionpinsrstudio
7.41 score 59 stars 7 dependents 132 scripts 1.1k downloads
connectwidgets - Organize and Curate Your Content Within 'Posit Connect'
A collection of helper functions and 'htmlwidgets' to help publishers curate content collections on 'Posit Connect'. The components, Card, Grid, Table, Search, and Filter can be used to produce a showcase page or gallery contained within a static or interactive R Markdown page.
Last updated
6.91 score 22 stars 41 scripts 397 downloads
plumbertableau - Turn 'Plumber' APIs into 'Tableau' Extensions
Build 'Plumber' APIs that can be used in 'Tableau' workbooks. Annotations in R comments allow APIs to conform to the 'Tableau Analytics Extension' specification, so that R code can be used to power 'Tableau' workbooks.
Last updated
6.90 score 32 stars 25 scripts 161 downloadsshinyloadtest - Load Test Shiny Applications
Assesses the number of concurrent users 'shiny' applications are capable of supporting, and for directing application changes in order to support a higher number of users. Provides facilities for recording 'shiny' application sessions, playing recorded sessions against a target server at load, and analyzing the resulting metrics.
Last updated
6.90 score 112 stars 71 scripts 375 downloadsrscontract - Generic implementation of the 'RStudio' connections contract
Provides a generic implementation of the 'RStudio' connection contract to make it easier for database connections, and other type of connections, opened via R packages integrate with the connections pane inside the 'RStudio' interactive development environment (IDE).
Last updated
connections-panerstudio
5.72 score 22 stars 8 dependents 4 scripts 774 downloadsgraphframes - Interface for 'GraphFrames'
A 'sparklyr' <https://spark.rstudio.com/> extension that provides an R interface for 'GraphFrames' <https://graphframes.github.io/>. 'GraphFrames' is a package for 'Apache Spark' that provides a DataFrame-based API for working with graphs. Functionality includes motif finding and common graph algorithms, such as PageRank and Breadth-first search.
Last updated
graphframesgraphspageranksparksparklyr
5.14 score 38 stars 72 scripts 29 downloads
ggcheck - Inspect 'ggplot2' Plots for Automated Grading in Learning Exercises
'ggcheck' provides functions that inspect 'ggplot2' objects to make it easier for teachers to check that student plots meet expectations. Designed primarily for automated grading via 'gradethis' in interactive 'learnr' tutorials.
Last updated
autogradingggplot2gradethislearnr
4.94 score 23 stars 94 scripts
tblcheck - Grade Tables in Learning Exercises
'tblcheck' extends 'gradethis' with functions that inspect data frame or tibble objects to make it easier for teachers to check that student tables meet expectations.
Last updated
autogradinggradethislearnrtablestibbles
4.43 score 9 stars 7 scriptsacademyDatasets - Datasets for RStudio Academy
A set of datasets for use with RStudio Academy exercises, tutorials, and recipes.
Last updated
3.35 score 5 stars 3 scripts