rmarkdown - Dynamic Documents for R

Convert R Markdown documents into a variety of formats.

Last updated 17 days ago

literate-programmingmarkdownpandocrmarkdown

21.95 score 2.9k stars 3.6k packages 13k scripts 1.1M downloads

shiny - Web Application Framework for R

Makes it incredibly easy to build interactive web applications with R. Automatic "reactive" binding between inputs and outputs and extensive prebuilt widgets make it possible to build beautiful, responsive, and powerful applications with minimal effort.

Last updated 14 days ago

reactiverstudioshinyweb-appweb-development

21.20 score 5.4k stars 1.7k packages 96k scripts 558k downloads

reticulate - Interface to 'Python'

Interface to 'Python' modules, classes, and functions. When calling into 'Python', R data types are automatically converted to their equivalent 'Python' types. When values are returned from 'Python' to R they are converted back to R types. Compatible with all versions of 'Python' >= 2.7.

Last updated 6 days ago

20.85 score 1.7k stars 407 packages 12k scripts 315k downloads

DT - A Wrapper of the JavaScript Library 'DataTables'

Data objects in R can be rendered as HTML tables using the JavaScript library 'DataTables' (typically via R Markdown or Shiny). The 'DataTables' library has been included in this R package. The package name 'DT' is an abbreviation of 'DataTables'.

Last updated 8 months ago

datatableshtmlwidgetsjavascriptshiny

19.48 score 599 stars 633 packages 31k scripts 447k downloads

rstudioapi - Safely Access the RStudio API

Access the RStudio API (if available) and provide informative error messages when it's not.

Last updated 17 days ago

19.04 score 168 stars 2.0k packages 3.6k scripts 813k downloads

gt - Easily Create Presentation-Ready Display Tables

Build display tables from tabular data with an easy-to-use set of functions. With its progressive approach, we can construct display tables with a cohesive set of table parts. Table values can be formatted using any of the included formatting functions. Footnotes and cell styles can be precisely added through a location targeting system. The way in which 'gt' handles things for you means that you don't often have to worry about the fine details.

Last updated 22 hours ago

docxeasy-to-usehtmllatexrtfsummary-tables

18.38 score 2.0k stars 105 packages 16k scripts 310k downloads

renv - Project Environments

A dependency management toolkit for R. Using 'renv', you can create and manage project-local R libraries, save the state of these libraries to a 'lockfile', and later restore your library as required. Together, these tools can help make your projects more isolated, portable, and reproducible.

Last updated 2 hours ago

18.11 score 1.0k stars 109 packages 1.3k scripts 202k downloads

bslib - Custom 'Bootstrap' 'Sass' Themes for 'shiny' and 'rmarkdown'

Simplifies custom 'CSS' styling of both 'shiny' and 'rmarkdown' via 'Bootstrap' 'Sass'. Supports 'Bootstrap' 3, 4 and 5 as well as their various 'Bootswatch' themes. An interactive widget is also provided for previewing themes in real time.

Last updated 2 days ago

bootstraphtmltoolsrmarkdownsassshiny

17.91 score 489 stars 4.2k packages 4.3k scripts 1.1M downloads

tinytex - Helper Functions to Install and Maintain TeX Live, and Compile LaTeX Documents

Helper functions to install and maintain the 'LaTeX' distribution named 'TinyTeX' (<https://yihui.org/tinytex/>), a lightweight, cross-platform, portable, and easy-to-maintain version of 'TeX Live'. This package also contains helper functions to compile 'LaTeX' documents, and install missing 'LaTeX' packages automatically.

Last updated 10 days ago

latextexlive

17.83 score 987 stars 3.6k packages 2.3k scripts 992k downloads

htmltools - Tools for HTML

Tools for HTML generation and output.

Last updated 7 months ago

17.66 score 215 stars 4.3k packages 9.1k scripts 1.2M downloads

bookdown - Authoring Books and Technical Documents with R Markdown

Output formats and utilities for authoring books and technical documents with R Markdown.

Last updated 8 days ago

bookbookdownepubgitbookhtmllatexrmarkdown

17.63 score 3.8k stars 132 packages 1.7k scripts 75k downloads

leaflet - Create Interactive Web Maps with the JavaScript 'Leaflet' Library

Create and customize interactive maps using the 'Leaflet' JavaScript library and the 'htmlwidgets' package. These maps can be used directly from the R console, from 'RStudio', in Shiny applications and R Markdown documents.

Last updated 4 months ago

gisleaflet-mapspatial

17.22 score 808 stars 165 packages 36k scripts 67k downloads

promises - Abstractions for Promise-Based Asynchronous Programming

Provides fundamental abstractions for doing asynchronous programming in R using promises. Asynchronous programming is useful for allowing a single R process to orchestrate multiple tasks in the background while also attending to something else. Semantics are similar to 'JavaScript' promises, but with a syntax that is idiomatic R.

Last updated 8 months ago

16.40 score 203 stars 2.4k packages 608 scripts 632k downloads

fontawesome - Easily Work with 'Font Awesome' Icons

Easily and flexibly insert 'Font Awesome' icons into 'R Markdown' documents and 'Shiny' apps. These icons can be inserted into HTML content through inline 'SVG' tags or 'i' tags. There is also a utility function for exporting 'Font Awesome' icons as 'PNG' images for those situations where raster graphics are needed.

Last updated 5 days ago

font-awesomesvg-icons

16.14 score 294 stars 4.2k packages 3.2k scripts 981k downloads

httpuv - HTTP and WebSocket Server Library

Provides low-level socket and protocol support for handling HTTP and WebSocket requests directly from within R. It is primarily intended as a building block for other packages, rather than making it particularly easy to create complete web applications using httpuv alone. httpuv is built on top of the libuv and http-parser C libraries, both of which were developed by Joyent, Inc. (See LICENSE file for libuv and http-parser license information.)

Last updated 8 months ago

15.91 score 228 stars 2.0k packages 716 scripts 594k downloads

sass - Syntactically Awesome Style Sheets ('Sass')

An 'SCSS' compiler, powered by the 'LibSass' library. With this, R developers can use variables, inheritance, and functions to generate dynamic style sheets. The package uses the 'Sass CSS' extension language, which is stable, powerful, and CSS compatible.

Last updated 7 months ago

15.89 score 102 stars 4.2k packages 236 scripts 1.1M downloads

shinydashboard - Create Dashboards with 'Shiny'

Create dashboards with 'Shiny'. This package provides a theme on top of 'Shiny', making it easy to create attractive dashboards.

Last updated 3 years ago

admin-dashboarddashboardreactivityrstudioshinyshinydashboardweb-appweb-development

15.54 score 894 stars 193 packages 15k scripts 96k downloads

config - Manage Environment Specific Configuration Values

Manage configuration values across multiple environments (e.g. development, test, production). Read values using a function that determines the current environment and returns the appropriate value.

Last updated 8 months ago

15.29 score 256 stars 199 packages 1.6k scripts 38k downloads

tensorflow - R Interface to 'TensorFlow'

Interface to 'TensorFlow' <https://www.tensorflow.org/>, an open source software library for numerical computation using data flow graphs. Nodes in the graph represent mathematical operations, while the graph edges represent the multidimensional data arrays (tensors) communicated between them. The flexible architecture allows you to deploy computation to one or more 'CPUs' or 'GPUs' in a desktop, server, or mobile device with a single 'API'. 'TensorFlow' was originally developed by researchers and engineers working on the Google Brain Team within Google's Machine Intelligence research organization for the purposes of conducting machine learning and deep neural networks research, but the system is general enough to be applicable in a wide variety of other domains as well.

Last updated 22 days ago

15.20 score 1.3k stars 76 packages 2.8k scripts 20k downloads

learnr - Interactive Tutorials for R

Create interactive tutorials using R Markdown. Use a combination of narrative, figures, videos, exercises, and quizzes to create self-paced tutorials for learning about R and R packages.

Last updated 3 months ago

interactivepythonrmarkdownshinysqlteachingtutorial

14.98 score 713 stars 26 packages 6.4k scripts 20k downloads

rsconnect - Deploy Docs, Apps, and APIs to 'Posit Connect', 'shinyapps.io', and 'RPubs'

Programmatic deployment interface for 'RPubs', 'shinyapps.io', and 'Posit Connect'. Supported content types include R Markdown documents, Shiny applications, Plumber APIs, plots, and static web content.

Last updated 2 days ago

14.91 score 134 stars 6 packages 2.8k scripts 55k downloads

markdown - Render Markdown with 'commonmark'

Render Markdown to full and lightweight HTML/LaTeX documents with the 'commonmark' package. This package has been superseded by 'litedown'.

Last updated 5 months ago

commonmarkmarkdown

14.83 score 84 stars 419 packages 3.2k scripts 382k downloads

crosstalk - Inter-Widget Interactivity for HTML Widgets

Provides building blocks for allowing HTML widgets to communicate with each other, with Shiny or without (i.e. static .html files). Currently supports linked brushing and filtering.

Last updated 12 months ago

14.65 score 290 stars 1.4k packages 1.5k scripts 513k downloads

plumber - An API Generator for R

Gives the ability to automatically generate and serve an HTTP API from R functions using the annotations in the R documentation around your functions.

Last updated 7 days ago

apiapi-serverplumber

14.45 score 1.4k stars 17 packages 1.8k scripts 135k downloads

pins - Pin, Discover, and Share Resources

Publish data sets, models, and other R objects, making it easy to share them across projects and with your colleagues. You can pin objects to a variety of "boards", including local folders (to share on a networked drive or with 'DropBox'), 'Posit Connect', 'AWS S3', and more.

Last updated 2 months ago

azuregcloudrpinsrsconnects3storage

14.30 score 315 stars 18 packages 1.7k scripts 5.0k downloads

keras3 - R Interface to 'Keras'

Interface to 'Keras' <https://keras.io>, a high-level neural networks API. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both CPU and GPU devices.

Last updated 21 days ago

13.50 score 838 stars 2 packages 216 scripts 4.0k downloads

dygraphs - Interface to 'Dygraphs' Interactive Time Series Charting Library

An R interface to the 'dygraphs' JavaScript charting library (a copy of which is included in the package). Provides rich facilities for charting time-series data in R, including highly configurable series- and axis-display and interactive features like zoom/pan and series/point highlighting.

Last updated 2 years ago

13.42 score 365 stars 58 packages 3.4k scripts 36k downloads

pool - Object Pooling

Enables the creation of object pools, which make it less computationally expensive to fetch a new object. Currently the only supported pooled objects are 'DBI' connections.

Last updated 2 months ago

13.08 score 252 stars 25 packages 584 scripts 14k downloads

shinythemes - Themes for Shiny

Themes for use with Shiny. Includes several Bootstrap themes from <https://bootswatch.com/>, which are packaged for use with Shiny applications.

Last updated 3 years ago

13.04 score 152 stars 115 packages 7.5k scripts 31k downloads

shinytest2 - Testing for Shiny Applications

Automated unit testing of Shiny applications through a headless 'Chromium' browser.

Last updated 2 months ago

12.66 score 106 stars 1 packages 652 scripts 61k downloads

flexdashboard - R Markdown Format for Flexible Dashboards

Format for converting an R Markdown document to a grid oriented dashboard. The dashboard flexibly adapts the size of it's components to the containing web page.

Last updated 7 months ago

12.54 score 813 stars 9 packages 4.0k scripts 9.8k downloads

tfruns - Training Run Tools for 'TensorFlow'

Create and manage unique directories for each 'TensorFlow' training run. Provides a unique, time stamped directory for each run along with functions to retrieve the directory of the latest run or latest several runs.

Last updated 7 months ago

12.27 score 34 stars 78 packages 312 scripts 16k downloads

packrat - A Dependency Management System for Projects and their R Package Dependencies

Manage the R packages your project depends on in an isolated, portable, and reproducible way.

Last updated 11 months ago

12.12 score 401 stars 9 packages 243 scripts 42k downloads

r2d3 - Interface to 'D3' Visualizations

Suite of tools for using 'D3', a library for producing dynamic, interactive data visualizations. Supports translating objects into 'D3' friendly data structures, rendering 'D3' scripts, publishing 'D3' visualizations, incorporating 'D3' in R Markdown, creating interactive 'D3' applications with Shiny, and distributing 'D3' based 'htmlwidgets' in R packages.

Last updated 3 years ago

d3r2d3visualization

11.85 score 518 stars 10 packages 484 scripts 2.8k downloads

chromote - Headless Chrome Web Browser Interface

An implementation of the 'Chrome DevTools Protocol', for controlling a headless Chrome web browser.

Last updated 3 months ago

11.76 score 156 stars 25 packages 120 scripts 69k downloads

pagedown - Paginate the HTML Output of R Markdown with CSS for Print

Use the paged media properties in CSS and the JavaScript library 'paged.js' to split the content of an HTML document into discrete pages. Each page can have its page size, page numbers, margin boxes, and running headers, etc. Applications of this package include books, letters, reports, papers, business cards, resumes, and posters.

Last updated 1 months ago

csshtmlpaged-mediapdfprintingtypesetting

11.74 score 892 stars 16 packages 370 scripts 16k downloads

rticles - Article Formats for R Markdown

A suite of custom R Markdown formats and templates for authoring journal articles and conference submissions.

Last updated 6 months ago

articlejournalpaperrmarkdown

11.55 score 1.5k stars 2 packages 176 scripts 6.1k downloads

sortable - Drag-and-Drop in 'shiny' Apps with 'SortableJS'

Enables drag-and-drop behaviour in Shiny apps, by exposing the functionality of the 'SortableJS' <https://sortablejs.github.io/Sortable/> JavaScript library as an 'htmlwidget'. You can use this in Shiny apps and widgets, 'learnr' tutorials as well as R Markdown. In addition, provides a custom 'learnr' question type - 'question_rank()' - that allows ranking questions with drag-and-drop.

Last updated 2 months ago

htmlwidget

11.47 score 134 stars 11 packages 343 scripts 2.7k downloads

blogdown - Create Blogs and Websites with R Markdown

Write blog posts and web pages in R Markdown. This package supports the static site generator 'Hugo' (<https://gohugo.io>) best, and it also supports 'Jekyll' (<https://jekyllrb.com>) and 'Hexo' (<https://hexo.io>).

Last updated 2 months ago

blog-engineblogdownhugormarkdownrstudiowebsite-generation

11.41 score 1.7k stars 1 packages 1.5k scripts 2.8k downloads

websocket - 'WebSocket' Client Library

Provides a 'WebSocket' client interface for R. 'WebSocket' is a protocol for low-overhead real-time communication: <https://en.wikipedia.org/wiki/WebSocket>.

Last updated 4 months ago

11.16 score 92 stars 45 packages 47 scripts 82k downloads

leaflet.providers - Leaflet Providers

Contains third-party map tile provider information from 'Leaflet.js', <https://github.com/leaflet-extras/leaflet-providers>, to be used with the 'leaflet' R package. Additionally, 'leaflet.providers' enables users to retrieve up-to-date provider information between package updates.

Last updated 1 years ago

11.13 score 14 stars 165 packages 390 scripts 50k downloads

keras - R Interface to 'Keras'

Interface to 'Keras' <https://keras.io>, a high-level neural networks 'API'. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both 'CPU' and 'GPU' devices.

Last updated 7 months ago

10.93 score 57 packages 9.8k scripts 23k downloads

webshot2 - Take Screenshots of Web Pages

Takes screenshots of web pages, including Shiny applications and R Markdown documents. 'webshot2' uses headless Chrome or Chromium as the browser back-end.

Last updated 1 years ago

10.79 score 111 stars 19 packages 872 scripts 25k downloads

blastula - Easily Send HTML Email Messages

Compose and send out responsive HTML email messages that render perfectly across a range of email clients and device sizes. Helper functions let the user insert embedded images, web link buttons, and 'ggplot2' plot objects into the message body. Messages can be sent through an 'SMTP' server, through the 'Posit Connect' service, or through the 'Mailgun' API service <https://www.mailgun.com/>.

Last updated 4 months ago

easy-to-useemailhtmlmarkdownresponsive-emailsmtp

10.78 score 547 stars 5 packages 358 scripts 5.7k downloads

vetiver - Version, Share, Deploy, and Monitor Models

The goal of 'vetiver' is to provide fluent tooling to version, share, deploy, and monitor a trained model. Functions handle both recording and checking the model's input data prototype, and predicting from a remote API endpoint. The 'vetiver' package is extensible, with generics that can support many kinds of models.

Last updated 1 months ago

10.70 score 183 stars 1 packages 472 scripts 1.3k downloads

pointblank - Data Validation and Organization of Metadata for Local and Remote Tables

Validate data in data frames, 'tibble' objects, 'Spark' 'DataFrames', and database tables. Validation pipelines can be made using easily-readable, consecutive validation steps. Upon execution of the validation plan, several reporting options are available. User-defined thresholds for failure rates allow for the determination of appropriate reporting actions. Many other workflows are available including an information management workflow, where the aim is to record, collect, and generate useful information on data tables.

Last updated 29 days ago

data-assertionsdata-checkerdata-dictionariesdata-framesdata-inferencedata-managementdata-profilerdata-qualitydata-validationdata-verificationdatabase-tableseasy-to-understandreporting-toolschema-validationtesting-toolsyaml-configuration

10.50 score 870 stars 250 scripts 9.9k downloads

connectapi - Utilities for Interacting with the 'Posit Connect' Server API

Provides a helpful 'R6' class and methods for interacting with the 'Posit Connect' Server API along with some meaningful utility functions for regular tasks. API documentation varies by 'Posit Connect' installation and version, but the latest documentation is also hosted publicly at <https://docs.posit.co/connect/api/>.

Last updated 2 hours ago

api-clientrstudio-connect

10.18 score 45 stars 1 packages 227 scripts 1.4k downloads

tufte - Tufte's Styles for R Markdown Documents

Provides R Markdown output formats to use Tufte styles for PDF and HTML output.

Last updated 1 years ago

r-markdowntuftetufte-style

9.98 score 400 stars 3 packages 1.5k scripts 2.9k downloads

distill - 'R Markdown' Format for Scientific and Technical Writing

Scientific and technical article format for the web. 'Distill' articles feature attractive, reader-friendly typography, flexible layout options for visualizations, and full support for footnotes and citations.

Last updated 1 years ago

9.84 score 422 stars 6 packages 424 scripts 2.2k downloads

thematic - Unified and Automatic 'Theming' of 'ggplot2', 'lattice', and 'base' R Graphics

Theme 'ggplot2', 'lattice', and 'base' graphics based on a few choices, including foreground color, background color, accent color, and font family. Fonts that aren't available on the system, but are available via download on 'Google Fonts', can be automatically downloaded, cached, and registered for use with the 'showtext' and 'ragg' packages.

Last updated 4 months ago

9.74 score 243 stars 3 packages 712 scripts 4.5k downloads

tfdatasets - Interface to 'TensorFlow' Datasets

Interface to 'TensorFlow' Datasets, a high-level library for building complex input pipelines from simple, re-usable pieces. See <https://www.tensorflow.org/guide> for additional details.

Last updated 4 months ago

9.65 score 34 stars 4 packages 660 scripts 2.2k downloads

shinytest - Test Shiny Apps

Please see the shinytest to shinytest2 migration guide at <https://rstudio.github.io/shinytest2/articles/z-migration.html>.

Last updated 6 months ago

9.37 score 225 stars 334 scripts 8.3k downloads

bigD - Flexibly Format Dates and Times to a Given Locale

Format dates and times flexibly and to whichever locales make sense. Parses dates, times, and date-times in various formats (including string-based ISO 8601 constructions). The formatting syntax gives the user many options for formatting the date and time output in a precise manner. Time zones in the input can be expressed in multiple ways and there are many options for formatting time zones in the output as well. Several of the provided helper functions allow for automatic generation of locale-aware formatting patterns based on date/time skeleton formats and standardized date/time formats with varying specificity.

Last updated 13 days ago

datedatetimeeasy-to-usei18ntime

9.33 score 17 stars 103 packages 1 scripts 274k downloads

shinyvalidate - Input Validation for Shiny Apps

Improves the user experience of Shiny apps by helping to provide feedback when required inputs are missing, or input values are not valid.

Last updated 1 years ago

shinyuivalidation

8.95 score 110 stars 13 packages 303 scripts 3.4k downloads

swagger - Dynamically Generates Documentation from a 'Swagger' Compliant API

A collection of 'HTML', 'JavaScript', and 'CSS' assets that dynamically generate beautiful documentation from a 'Swagger' compliant API: <https://swagger.io/specification/>.

Last updated 5 months ago

8.80 score 53 stars 20 packages 14 scripts 16k downloads

tfprobability - Interface to 'TensorFlow Probability'

Interface to 'TensorFlow Probability', a 'Python' library built on 'TensorFlow' that makes it easy to combine probabilistic models and deep learning on modern hardware ('TPU', 'GPU'). 'TensorFlow Probability' includes a wide selection of probability distributions and bijectors, probabilistic layers, variational inference, Markov chain Monte Carlo, and optimizers such as Nelder-Mead, BFGS, and SGLD.

Last updated 2 years ago

8.75 score 54 stars 4 packages 219 scripts 337 downloads

bundle - Serialize Model Objects with a Consistent Interface

Typically, models in 'R' exist in memory and can be saved via regular 'R' serialization. However, some models store information in locations that cannot be saved using 'R' serialization alone. The goal of 'bundle' is to provide a common interface to capture this information, situate it within a portable object, and restore it for use in new settings.

Last updated 9 days ago

8.65 score 28 stars 2 packages 171 scripts 1.3k downloads

nomnoml - Sassy 'UML' Diagrams

A tool for drawing sassy 'UML' (Unified Modeling Language) diagrams based on a simple syntax, see <https://www.nomnoml.com>. Supports styling, R Markdown and exporting diagrams in the PNG format. Note: you need a chromium based browser installed on your system.

Last updated 8 months ago

diagramshtmlwidgetsnomnomluml

8.46 score 220 stars 4 packages 109 scripts 400 downloads

tfestimators - Interface to 'TensorFlow' Estimators

Interface to 'TensorFlow' Estimators <https://www.tensorflow.org/guide/estimator>, a high-level API that provides implementations of many different model types including linear models and deep neural networks.

Last updated 3 years ago

8.41 score 57 stars 166 scripts 1.0k downloads

juicyjuice - Inline CSS Properties into HTML Tags Using 'juice'

There are occasions where you need a piece of HTML with integrated styles. A prime example of this is HTML email. This transformation involves moving the CSS and associated formatting instructions from the style block in the head of your document into the body of the HTML. Many prominent email clients require integrated styles in HTML email; otherwise a received HTML email will be displayed without any styling. This package will quickly and precisely perform these CSS transformations when given HTML text and it does so by using the JavaScript 'juice' library.

Last updated 11 months ago

csshtmlinlining

8.11 score 3 stars 104 packages 1 scripts 276k downloads

reactlog - Reactivity Visualizer for 'shiny'

Building interactive web applications with R is incredibly easy with 'shiny'. Behind the scenes, 'shiny' builds a reactive graph that can quickly become intertwined and difficult to debug. 'reactlog' (Schloerke 2019) <doi:10.5281/zenodo.2591517> provides a visual insight into that black box of 'shiny' reactivity by constructing a directed dependency graph of the application's reactive state at any time point in a reactive recording.

Last updated 2 years ago

7.97 score 124 stars 235 scripts 3.2k downloads

revealjs - R Markdown Format for 'reveal.js' Presentations

R Markdown format for 'reveal.js' presentations, a framework for easily creating beautiful presentations using HTML.

Last updated 2 years ago

7.96 score 325 stars 1 packages 135 scripts 916 downloads

webdriver - 'WebDriver' Client for 'PhantomJS'

A client for the 'WebDriver' 'API'. It allows driving a (probably headless) web browser, and can be used to test web applications, including 'Shiny' apps. In theory it works with any 'WebDriver' implementation, but it was only tested with 'PhantomJS'.

Last updated 3 years ago

7.74 score 70 stars 3 packages 90 scripts 6.5k downloads

bsicons - Easily Work with 'Bootstrap' Icons

Easily use 'Bootstrap' icons inside 'Shiny' apps and 'R Markdown' documents. More generally, icons can be inserted in any 'htmltools' document through inline 'SVG'.

Last updated 1 years ago

7.60 score 15 stars 12 packages 390 scripts 3.8k downloads

shinymeta - Export Domain Logic from Shiny using Meta-Programming

Provides tools for capturing logic in a Shiny app and exposing it as code that can be run outside of Shiny (e.g., from an R console). It also provides tools for bundling both the code and results to the end user.

Last updated 7 months ago

7.54 score 223 stars 3 packages 58 scripts 377 downloads

tfhub - Interface to 'TensorFlow' Hub

'TensorFlow' Hub is a library for the publication, discovery, and consumption of reusable parts of machine learning models. A module is a self-contained piece of a 'TensorFlow' graph, along with its weights and assets, that can be reused across different tasks in a process known as transfer learning. Transfer learning train a model with a smaller dataset, improve generalization, and speed up training.

Last updated 3 years ago

7.44 score 28 stars 1 packages 73 scripts 326 downloads

shinyloadtest - Load Test Shiny Applications

Assesses the number of concurrent users 'shiny' applications are capable of supporting, and for directing application changes in order to support a higher number of users. Provides facilities for recording 'shiny' application sessions, playing recorded sessions against a target server at load, and analyzing the resulting metrics.

Last updated 3 months ago

7.12 score 110 stars 60 scripts 379 downloads

plumbertableau - Turn 'Plumber' APIs into 'Tableau' Extensions

Build 'Plumber' APIs that can be used in 'Tableau' workbooks. Annotations in R comments allow APIs to conform to the 'Tableau Analytics Extension' specification, so that R code can be used to power 'Tableau' workbooks.

Last updated 11 months ago

7.06 score 30 stars 24 scripts 401 downloads

connectwidgets - Organize and Curate Your Content Within 'Posit Connect'

A collection of helper functions and 'htmlwidgets' to help publishers curate content collections on 'Posit Connect'. The components, Card, Grid, Table, Search, and Filter can be used to produce a showcase page or gallery contained within a static or interactive R Markdown page.

Last updated 3 months ago

6.78 score 21 stars 36 scripts 573 downloads

connections - Integrates with the 'RStudio' Connections Pane and 'pins'

Enables 'DBI' compliant packages to integrate with the 'RStudio' connections pane, and the 'pins' package. It automates the display of schemata, tables, views, as well as the preview of the table's top 1000 records.

Last updated 11 months ago

connection-panedatabase-connectionpinsrstudio

6.77 score 56 stars 1 packages 118 scripts 305 downloads

graphframes - Interface for 'GraphFrames'

A 'sparklyr' <https://spark.rstudio.com/> extension that provides an R interface for 'GraphFrames' <https://graphframes.github.io/>. 'GraphFrames' is a package for 'Apache Spark' that provides a DataFrame-based API for working with graphs. Functionality includes motif finding and common graph algorithms, such as PageRank and Breadth-first search.

Last updated 6 years ago

graphframesgraphspageranksparksparklyr

5.20 score 38 stars 84 scripts 245 downloads

rscontract - Generic implementation of the 'RStudio' connections contract

Provides a generic implementation of the 'RStudio' connection contract to make it easier for database connections, and other type of connections, opened via R packages integrate with the connections pane inside the 'RStudio' interactive development environment (IDE).

Last updated 4 years ago

connections-panerstudio

5.12 score 22 stars 2 packages 4 scripts 319 downloads