![](https://github.com/rstudio/rmarkdown/raw/HEAD/man/figures/logo.png)
rmarkdown - Dynamic Documents for R
Convert R Markdown documents into a variety of formats.
Last updated 25 days ago
literate-programmingmarkdownpandocrmarkdown
2.8k stars 17.13 score 25 dependencies 3389 dependents![](https://github.com/rstudio/htmltools/raw/HEAD/man/figures/logo.png)
htmltools - Tools for HTML
Tools for HTML generation and output.
Last updated 3 months ago
213 stars 16.94 score 4 dependencies 4092 dependentsbslib - Custom 'Bootstrap' 'Sass' Themes for 'shiny' and 'rmarkdown'
Simplifies custom 'CSS' styling of both 'shiny' and 'rmarkdown' via 'Bootstrap' 'Sass'. Supports 'Bootstrap' 3, 4 and 5 as well as their various 'Bootswatch' themes. An interactive widget is also provided for previewing themes in real time.
Last updated 12 hours ago
bootstraphtmltoolsrmarkdownsassshiny
447 stars 16.91 score 17 dependencies 3981 dependentsfontawesome - Easily Work with 'Font Awesome' Icons
Easily and flexibly insert 'Font Awesome' icons into 'R Markdown' documents and 'Shiny' apps. These icons can be inserted into HTML content through inline 'SVG' tags or 'i' tags. There is also a utility function for exporting 'Font Awesome' icons as 'PNG' images for those situations where raster graphics are needed.
Last updated 4 months ago
font-awesomesvg-icons
292 stars 16.84 score 5 dependencies 3957 dependentssass - Syntactically Awesome Style Sheets ('Sass')
An 'SCSS' compiler, powered by the 'LibSass' library. With this, R developers can use variables, inheritance, and functions to generate dynamic style sheets. The package uses the 'Sass CSS' extension language, which is stable, powerful, and CSS compatible.
Last updated 3 months ago
102 stars 16.80 score 8 dependencies 3981 dependentstinytex - Helper Functions to Install and Maintain TeX Live, and Compile LaTeX Documents
Helper functions to install and maintain the 'LaTeX' distribution named 'TinyTeX' (<https://yihui.org/tinytex/>), a lightweight, cross-platform, portable, and easy-to-maintain version of 'TeX Live'. This package also contains helper functions to compile 'LaTeX' documents, and install missing 'LaTeX' packages automatically.
Last updated 9 days ago
latextexlive
956 stars 16.55 score 1 dependencies 3402 dependents![](https://github.com/rstudio/shiny/raw/HEAD/man/figures/logo.png)
shiny - Web Application Framework for R
Makes it incredibly easy to build interactive web applications with R. Automatic "reactive" binding between inputs and outputs and extensive prebuilt widgets make it possible to build beautiful, responsive, and powerful applications with minimal effort.
Last updated 16 hours ago
reactiverstudioshinyweb-appweb-development
5.3k stars 16.47 score 29 dependencies 1749 dependentspromises - Abstractions for Promise-Based Asynchronous Programming
Provides fundamental abstractions for doing asynchronous programming in R using promises. Asynchronous programming is useful for allowing a single R process to orchestrate multiple tasks in the background while also attending to something else. Semantics are similar to 'JavaScript' promises, but with a syntax that is idiomatic R.
Last updated 4 months ago
197 stars 15.15 score 6 dependencies 2375 dependentshttpuv - HTTP and WebSocket Server Library
Provides low-level socket and protocol support for handling HTTP and WebSocket requests directly from within R. It is primarily intended as a building block for other packages, rather than making it particularly easy to create complete web applications using httpuv alone. httpuv is built on top of the libuv and http-parser C libraries, both of which were developed by Joyent, Inc. (See LICENSE file for libuv and http-parser license information.)
Last updated 4 months ago
224 stars 14.66 score 7 dependencies 2005 dependents![](https://github.com/rstudio/rstudioapi/raw/HEAD/man/figures/logo.png)
rstudioapi - Safely Access the RStudio API
Access the RStudio API (if available) and provide informative error messages when it's not.
Last updated 16 days ago
165 stars 14.54 score 0 dependencies 1930 dependentscrosstalk - Inter-Widget Interactivity for HTML Widgets
Provides building blocks for allowing HTML widgets to communicate with each other, with Shiny or without (i.e. static .html files). Currently supports linked brushing and filtering.
Last updated 8 months ago
287 stars 13.39 score 8 dependencies 1316 dependents![](https://github.com/rstudio/bookdown/raw/HEAD/man/figures/logo.png)
bookdown - Authoring Books and Technical Documents with R Markdown
Output formats and utilities for authoring books and technical documents with R Markdown.
Last updated 3 days ago
bookbookdownepubgitbookhtmllatexrmarkdown
3.7k stars 13.19 score 26 dependencies 125 dependentsreticulate - Interface to 'Python'
Interface to 'Python' modules, classes, and functions. When calling into 'Python', R data types are automatically converted to their equivalent 'Python' types. When values are returned from 'Python' to R they are converted back to R types. Compatible with all versions of 'Python' >= 2.7.
Last updated 29 days ago
1.6k stars 12.25 score 11 dependencies 372 dependentsDT - A Wrapper of the JavaScript Library 'DataTables'
Data objects in R can be rendered as HTML tables using the JavaScript library 'DataTables' (typically via R Markdown or Shiny). The 'DataTables' library has been included in this R package. The package name 'DT' is an abbreviation of 'DataTables'.
Last updated 4 months ago
datatableshtmlwidgetsjavascriptshiny
587 stars 12.00 score 34 dependencies 594 dependentsgt - Easily Create Presentation-Ready Display Tables
Build display tables from tabular data with an easy-to-use set of functions. With its progressive approach, we can construct display tables with a cohesive set of table parts. Table values can be formatted using any of the included formatting functions. Footnotes and cell styles can be precisely added through a location targeting system. The way in which 'gt' handles things for you means that you don't often have to worry about the fine details.
Last updated 3 days ago
docxeasy-to-usehtmllatexrtfsummary-tables
2.0k stars 11.58 score 56 dependencies 93 dependents![](https://bookdown.org/yihui/blogdown/images/logo.png)
blogdown - Create Blogs and Websites with R Markdown
Write blog posts and web pages in R Markdown. This package supports the static site generator 'Hugo' (<https://gohugo.io>) best, and it also supports 'Jekyll' (<https://jekyllrb.com>) and 'Hexo' (<https://hexo.io>).
Last updated 6 months ago
blog-engineblogdownhugormarkdownrstudiowebsite-generation
1.7k stars 10.58 score 33 dependencies 1 dependentsrenv - Project Environments
A dependency management toolkit for R. Using 'renv', you can create and manage project-local R libraries, save the state of these libraries to a 'lockfile', and later restore your library as required. Together, these tools can help make your projects more isolated, portable, and reproducible.
Last updated 1 days ago
986 stars 10.56 score 0 dependencies 106 dependentsplumber - An API Generator for R
Gives the ability to automatically generate and serve an HTTP API from R functions using the annotations in the R documentation around your functions.
Last updated 24 days ago
apiapi-serverplumber
1.4k stars 10.26 score 19 dependencies 17 dependents![](https://github.com/rstudio/rticles/raw/HEAD/man/figures/logo.png)
rticles - Article Formats for R Markdown
A suite of custom R Markdown formats and templates for authoring journal articles and conference submissions.
Last updated 2 months ago
articlejournalpaperrmarkdown
1.5k stars 10.23 score 26 dependencies 1 dependentsshinydashboard - Create Dashboards with 'Shiny'
Create dashboards with 'Shiny'. This package provides a theme on top of 'Shiny', making it easy to create attractive dashboards.
Last updated 3 years ago
admin-dashboarddashboardreactivityrstudioshinyshinydashboardweb-appweb-development
883 stars 10.20 score 30 dependencies 185 dependentsmarkdown - Render Markdown with 'commonmark'
Render Markdown to full and lightweight HTML/LaTeX documents with the 'commonmark' package. This package has been superseded by 'litedown'.
Last updated 1 months ago
commonmarkmarkdown
85 stars 10.15 score 2 dependencies 381 dependentsleaflet - Create Interactive Web Maps with the JavaScript 'Leaflet' Library
Create and customize interactive maps using the 'Leaflet' JavaScript library and the 'htmlwidgets' package. These maps can be used directly from the R console, from 'RStudio', in Shiny applications and R Markdown documents.
Last updated 16 hours ago
gisleaflet-mapspatial
798 stars 9.92 score 44 dependencies 152 dependents![](https://github.com/rstudio/pagedown/raw/HEAD/man/figures/logo.png)
pagedown - Paginate the HTML Output of R Markdown with CSS for Print
Use the paged media properties in CSS and the JavaScript library 'paged.js' to split the content of an HTML document into discrete pages. Each page can have its page size, page numbers, margin boxes, and running headers, etc. Applications of this package include books, letters, reports, papers, business cards, resumes, and posters.
Last updated 7 months ago
csshtmlpaged-mediapdfprintingtypesetting
879 stars 8.88 score 38 dependencies 15 dependentskeras3 - R Interface to 'Keras'
Interface to 'Keras' <https://keras.io>, a high-level neural networks API. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both CPU and GPU devices.
Last updated 10 days ago
830 stars 8.75 score 33 dependencies 1 dependentsprofvis - Interactive Visualizations for Profiling R Code
Interactive visualizations for profiling R code.
Last updated 24 days ago
292 stars 8.68 score 28 dependencies 141 dependentspointblank - Data Validation and Organization of Metadata for Local and Remote Tables
Validate data in data frames, 'tibble' objects, 'Spark' 'DataFrames', and database tables. Validation pipelines can be made using easily-readable, consecutive validation steps. Upon execution of the validation plan, several reporting options are available. User-defined thresholds for failure rates allow for the determination of appropriate reporting actions. Many other workflows are available including an information management workflow, where the aim is to record, collect, and generate useful information on data tables.
Last updated 28 days ago
data-assertionsdata-checkerdata-dictionariesdata-framesdata-inferencedata-managementdata-profilerdata-qualitydata-validationdata-verificationdatabase-tableseasy-to-understandreporting-toolschema-validationtesting-toolsyaml-configuration
844 stars 8.68 score 88 dependenciesconfig - Manage Environment Specific Configuration Values
Manage configuration values across multiple environments (e.g. development, test, production). Read values using a function that determines the current environment and returns the appropriate value.
Last updated 4 months ago
255 stars 8.68 score 1 dependencies 188 dependents![](https://github.com/rstudio/flexdashboard/raw/HEAD/man/figures/logo.png)
flexdashboard - R Markdown Format for Flexible Dashboards
Format for converting an R Markdown document to a grid oriented dashboard. The dashboard flexibly adapts the size of it's components to the containing web page.
Last updated 3 months ago
805 stars 8.65 score 45 dependencies 9 dependents![](https://pkgs.rstudio.com/learnr/learnr-social.png)
learnr - Interactive Tutorials for R
Create interactive tutorials using R Markdown. Use a combination of narrative, figures, videos, exercises, and quizzes to create self-paced tutorials for learning about R and R packages.
Last updated 3 months ago
interactivepythonrmarkdownshinysqlteachingtutorial
705 stars 8.59 score 43 dependencies 25 dependentsdygraphs - Interface to 'Dygraphs' Interactive Time Series Charting Library
An R interface to the 'dygraphs' JavaScript charting library (a copy of which is included in the package). Provides rich facilities for charting time-series data in R, including highly configurable series- and axis-display and interactive features like zoom/pan and series/point highlighting.
Last updated 1 years ago
364 stars 7.78 score 31 dependencies 61 dependentsblastula - Easily Send HTML Email Messages
Compose and send out responsive HTML email messages that render perfectly across a range of email clients and device sizes. Helper functions let the user insert embedded images, web link buttons, and 'ggplot2' plot objects into the message body. Messages can be sent through an 'SMTP' server, through the 'Posit Connect' service, or through the 'Mailgun' API service <https://www.mailgun.com/>.
Last updated 17 days ago
easy-to-useemailhtmlmarkdownresponsive-emailsmtp
537 stars 7.69 score 50 dependencies 5 dependentsr2d3 - Interface to 'D3' Visualizations
Suite of tools for using 'D3', a library for producing dynamic, interactive data visualizations. Supports translating objects into 'D3' friendly data structures, rendering 'D3' scripts, publishing 'D3' visualizations, incorporating 'D3' in R Markdown, creating interactive 'D3' applications with Shiny, and distributing 'D3' based 'htmlwidgets' in R packages.
Last updated 3 years ago
d3r2d3visualization
515 stars 7.59 score 28 dependencies 10 dependentsleaflet.providers - Leaflet Providers
Contains third-party map tile provider information from 'Leaflet.js', <https://github.com/leaflet-extras/leaflet-providers>, to be used with the 'leaflet' R package. Additionally, 'leaflet.providers' enables users to retrieve up-to-date provider information between package updates.
Last updated 9 months ago
12 stars 7.56 score 5 dependencies 152 dependentsshinythemes - Themes for Shiny
Themes for use with Shiny. Includes several Bootstrap themes from <https://bootswatch.com/>, which are packaged for use with Shiny applications.
Last updated 2 years ago
151 stars 7.45 score 30 dependencies 111 dependentspackrat - A Dependency Management System for Projects and their R Package Dependencies
Manage the R packages your project depends on in an isolated, portable, and reproducible way.
Last updated 7 months ago
399 stars 7.42 score 0 dependencies 9 dependents![](https://github.com/rstudio/distill/raw/HEAD/man/figures/logo.png)
distill - 'R Markdown' Format for Scientific and Technical Writing
Scientific and technical article format for the web. 'Distill' articles feature attractive, reader-friendly typography, flexible layout options for visualizations, and full support for footnotes and citations.
Last updated 8 months ago
423 stars 7.16 score 48 dependencies 6 dependentsbigD - Flexibly Format Dates and Times to a Given Locale
Format dates and times flexibly and to whichever locales make sense. Parses dates, times, and date-times in various formats (including string-based ISO 8601 constructions). The formatting syntax gives the user many options for formatting the date and time output in a precise manner. Time zones in the input can be expressed in multiple ways and there are many options for formatting time zones in the output as well. Several of the provided helper functions allow for automatic generation of locale-aware formatting patterns based on date/time skeleton formats and standardized date/time formats with varying specificity.
Last updated 7 months ago
datedatetimeeasy-to-usei18ntime
17 stars 6.89 score 0 dependencies 90 dependentstufte - Tufte's Styles for R Markdown Documents
Provides R Markdown output formats to use Tufte styles for PDF and HTML output.
Last updated 1 years ago
r-markdowntuftetufte-style
394 stars 6.88 score 26 dependencies 2 dependents![](https://github.com/rstudio/pins-r/raw/HEAD/man/figures/logo.png)
pins - Pin, Discover and Share Resources
Publish data sets, models, and other R objects, making it easy to share them across projects and with your colleagues. You can pin objects to a variety of "boards", including local folders (to share on a networked drive or with 'DropBox'), 'RStudio' connect, Amazon S3, and more.
Last updated 1 months ago
azuregcloudrpinsrsconnects3storage
301 stars 6.85 score 27 dependencies 15 dependents![](https://github.com/rstudio/juicyjuice/raw/HEAD/man/figures/logo.png)
juicyjuice - Inline CSS Properties into HTML Tags Using 'juice'
There are occasions where you need a piece of HTML with integrated styles. A prime example of this is HTML email. This transformation involves moving the CSS and associated formatting instructions from the style block in the head of your document into the body of the HTML. Many prominent email clients require integrated styles in HTML email; otherwise a received HTML email will be displayed without any styling. This package will quickly and precisely perform these CSS transformations when given HTML text and it does so by using the JavaScript 'juice' library.
Last updated 8 months ago
csshtmlinlining
3 stars 6.82 score 4 dependencies 90 dependentsrevealjs - R Markdown Format for 'reveal.js' Presentations
R Markdown format for 'reveal.js' presentations, a framework for easily creating beautiful presentations using HTML.
Last updated 1 years ago
325 stars 6.46 score 26 dependencies 1 dependentspool - Object Pooling
Enables the creation of object pools, which make it less computationally expensive to fetch a new object. Currently the only supported pooled objects are 'DBI' connections.
Last updated 5 months ago
244 stars 6.33 score 5 dependencies 15 dependentstfruns - Training Run Tools for 'TensorFlow'
Create and manage unique directories for each 'TensorFlow' training run. Provides a unique, time stamped directory for each run along with functions to retrieve the directory of the latest run or latest several runs.
Last updated 3 months ago
34 stars 6.15 score 23 dependencies 77 dependents![](https://github.com/rstudio/rsconnect/raw/HEAD/man/figures/logo.png)
rsconnect - Deploy Docs, Apps, and APIs to 'Posit Connect', 'shinyapps.io', and 'RPubs'
Programmatic deployment interface for 'RPubs', 'shinyapps.io', and 'Posit Connect'. Supported content types include R Markdown documents, Shiny applications, Plumber APIs, plots, and static web content.
Last updated 24 days ago
128 stars 6.07 score 16 dependencies 5 dependents![](https://github.com/rstudio/thematic/raw/HEAD/man/figures/logo.png)
thematic - Unified and Automatic 'Theming' of 'ggplot2', 'lattice', and 'base' R Graphics
Theme 'ggplot2', 'lattice', and 'base' graphics based on a few choices, including foreground color, background color, accent color, and font family. Fonts that aren't available on the system, but are available via download on 'Google Fonts', can be automatically downloaded, cached, and registered for use with the 'showtext' and 'ragg' packages.
Last updated 17 days ago
242 stars 5.91 score 30 dependencies 3 dependentsshinytest - Test Shiny Apps
Please see the shinytest to shinytest2 migration guide at <https://rstudio.github.io/shinytest2/articles/z-migration.html>.
Last updated 2 months ago
225 stars 5.89 score 71 dependencieschromote - Headless Chrome Web Browser Interface
An implementation of the 'Chrome DevTools Protocol', for controlling a headless Chrome web browser.
Last updated 21 days ago
151 stars 5.87 score 14 dependencies 21 dependentswebsocket - 'WebSocket' Client Library
Provides a 'WebSocket' client interface for R. 'WebSocket' is a protocol for low-overhead real-time communication: <https://en.wikipedia.org/wiki/WebSocket>.
Last updated 5 days ago
92 stars 5.78 score 6 dependencies 41 dependentsnomnoml - Sassy 'UML' Diagrams
A tool for drawing sassy 'UML' (Unified Modeling Language) diagrams based on a simple syntax, see <https://www.nomnoml.com>. Supports styling, R Markdown and exporting diagrams in the PNG format. Note: you need a chromium based browser installed on your system.
Last updated 4 months ago
diagramshtmlwidgetsnomnomluml
218 stars 5.72 score 41 dependencies 4 dependentsshinymeta - Export Domain Logic from Shiny using Meta-Programming
Provides tools for capturing logic in a Shiny app and exposing it as code that can be run outside of Shiny (e.g., from an R console). It also provides tools for bundling both the code and results to the end user.
Last updated 3 months ago
222 stars 5.71 score 41 dependencies 2 dependents![](https://github.com/rstudio/vetiver-r/raw/HEAD/man/figures/logo.png)
vetiver - Version, Share, Deploy, and Monitor Models
The goal of 'vetiver' is to provide fluent tooling to version, share, deploy, and monitor a trained model. Functions handle both recording and checking the model's input data prototype, and predicting from a remote API endpoint. The 'vetiver' package is extensible, with generics that can support many kinds of models.
Last updated 8 days ago
177 stars 5.50 score 46 dependencies 1 dependentswebshot2 - Take Screenshots of Web Pages
Takes screenshots of web pages, including Shiny applications and R Markdown documents. 'webshot2' uses headless Chrome or Chromium as the browser back-end.
Last updated 10 months ago
109 stars 5.21 score 16 dependencies 16 dependentskeras - R Interface to 'Keras'
Interface to 'Keras' <https://keras.io>, a high-level neural networks 'API'. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both 'CPU' and 'GPU' devices.
Last updated 3 months ago
5.04 score 32 dependencies 57 dependents![](https://github.com/rstudio/sortable/raw/HEAD/man/figures/logo.png)
sortable - Drag-and-Drop in 'shiny' Apps with 'SortableJS'
Enables drag-and-drop behaviour in Shiny apps, by exposing the functionality of the 'SortableJS' <https://sortablejs.github.io/Sortable/> JavaScript library as an 'htmlwidget'. You can use this in Shiny apps and widgets, 'learnr' tutorials as well as R Markdown. In addition, provides a custom 'learnr' question type - 'question_rank()' - that allows ranking questions with drag-and-drop.
Last updated 4 months ago
htmlwidget
127 stars 4.99 score 46 dependencies 10 dependentsswagger - Dynamically Generates Documentation from a 'Swagger' Compliant API
A collection of 'HTML', 'JavaScript', and 'CSS' assets that dynamically generate beautiful documentation from a 'Swagger' compliant API: <https://swagger.io/specification/>.
Last updated 28 days ago
52 stars 4.90 score 0 dependencies 20 dependentsshinyvalidate - Input Validation for Shiny Apps
Improves the user experience of Shiny apps by helping to provide feedback when required inputs are missing, or input values are not valid.
Last updated 10 months ago
shinyuivalidation
108 stars 4.85 score 30 dependencies 12 dependentsshinytest2 - Testing for Shiny Applications
Automated unit testing of Shiny applications through a headless 'Chromium' browser.
Last updated 3 months ago
100 stars 4.53 score 70 dependencies 1 dependentsreactlog - Reactivity Visualizer for 'shiny'
Building interactive web applications with R is incredibly easy with 'shiny'. Behind the scenes, 'shiny' builds a reactive graph that can quickly become intertwined and difficult to debug. 'reactlog' (Schloerke 2019) <doi:10.5281/zenodo.2591517> provides a visual insight into that black box of 'shiny' reactivity by constructing a directed dependency graph of the application's reactive state at any time point in a reactive recording.
Last updated 2 years ago
121 stars 4.50 score 1 dependenciesshinyloadtest - Load Test Shiny Applications
Assesses the number of concurrent users 'shiny' applications are capable of supporting, and for directing application changes in order to support a higher number of users. Provides facilities for recording 'shiny' application sessions, playing recorded sessions against a target server at load, and analyzing the resulting metrics.
Last updated 8 days ago
109 stars 4.45 score 54 dependencieswebdriver - 'WebDriver' Client for 'PhantomJS'
A client for the 'WebDriver' 'API'. It allows driving a (probably headless) web browser, and can be used to test web applications, including 'Shiny' apps. In theory it works with any 'WebDriver' implementation, but it was only tested with 'PhantomJS'.
Last updated 3 years ago
68 stars 3.84 score 17 dependencies 3 dependentstfprobability - Interface to 'TensorFlow Probability'
Interface to 'TensorFlow Probability', a 'Python' library built on 'TensorFlow' that makes it easy to combine probabilistic models and deep learning on modern hardware ('TPU', 'GPU'). 'TensorFlow Probability' includes a wide selection of probability distributions and bijectors, probabilistic layers, variational inference, Markov chain Monte Carlo, and optimizers such as Nelder-Mead, BFGS, and SGLD.
Last updated 2 years ago
54 stars 3.55 score 33 dependencies 4 dependents![](https://github.com/rstudio/connectapi/raw/HEAD/man/figures/logo.png)
connectapi - Utilities for Interacting with the 'Posit Connect' Server API
Provides a helpful 'R6' class and methods for interacting with the 'Posit Connect' Server API along with some meaningful utility functions for regular tasks. API documentation varies by 'Posit Connect' installation and version, but the latest documentation is also hosted publicly at <https://docs.posit.co/connect/api/>.
Last updated 11 days ago
api-clientrstudio-connect
42 stars 3.54 score 24 dependencies 1 dependents![](https://github.com/rstudio/connections/raw/HEAD/man/figures/logo.png)
connections - Integrates with the 'RStudio' Connections Pane and 'pins'
Enables 'DBI' compliant packages to integrate with the 'RStudio' connections pane, and the 'pins' package. It automates the display of schemata, tables, views, as well as the preview of the table's top 1000 records.
Last updated 7 months ago
connection-panedatabase-connectionpinsrstudio
56 stars 3.41 score 39 dependencies 1 dependentstfestimators - Interface to 'TensorFlow' Estimators
Interface to 'TensorFlow' Estimators <https://www.tensorflow.org/guide/estimator>, a high-level API that provides implementations of many different model types including linear models and deep neural networks.
Last updated 3 years ago
57 stars 3.40 score 47 dependenciestfdatasets - Interface to 'TensorFlow' Datasets
Interface to 'TensorFlow' Datasets, a high-level library for building complex input pipelines from simple, re-usable pieces. See <https://www.tensorflow.org/guide> for additional details.
Last updated 10 days ago
34 stars 3.21 score 31 dependencies 4 dependentsbundle - Serialize Model Objects with a Consistent Interface
Typically, models in 'R' exist in memory and can be saved via regular 'R' serialization. However, some models store information in locations that cannot be saved using 'R' serialization alone. The goal of 'bundle' is to provide a common interface to capture this information, situate it within a portable object, and restore it for use in new settings.
Last updated 12 days ago
25 stars 2.80 score 8 dependencies 2 dependentsgraphframes - Interface for 'GraphFrames'
A 'sparklyr' <https://spark.rstudio.com/> extension that provides an R interface for 'GraphFrames' <https://graphframes.github.io/>. 'GraphFrames' is a package for 'Apache Spark' that provides a DataFrame-based API for working with graphs. Functionality includes motif finding and common graph algorithms, such as PageRank and Breadth-first search.
Last updated 5 years ago
graphframesgraphspageranksparksparklyr
38 stars 2.74 score 40 dependenciesplumbertableau - Turn 'Plumber' APIs into 'Tableau' Extensions
Build 'Plumber' APIs that can be used in 'Tableau' workbooks. Annotations in R comments allow APIs to conform to the 'Tableau Analytics Extension' specification, so that R code can be used to power 'Tableau' workbooks.
Last updated 7 months ago
30 stars 2.68 score 38 dependenciestfhub - Interface to 'TensorFlow' Hub
'TensorFlow' Hub is a library for the publication, discovery, and consumption of reusable parts of machine learning models. A module is a self-contained piece of a 'TensorFlow' graph, along with its weights and assets, that can be reused across different tasks in a process known as transfer learning. Transfer learning train a model with a smaller dataset, improve generalization, and speed up training.
Last updated 3 years ago
28 stars 2.58 score 30 dependencies 1 dependents![](https://github.com/rstudio/connectwidgets/raw/HEAD/man/figures/logo.png)
connectwidgets - Organize and Curate Your Content Within 'Posit Connect'
A collection of helper functions and 'htmlwidgets' to help publishers curate content collections on 'Posit Connect'. The components, Card, Grid, Table, Search, and Filter can be used to produce a showcase page or gallery contained within a static or interactive R Markdown page.
Last updated 10 months ago
21 stars 2.47 score 48 dependenciesbsicons - Easily Work with 'Bootstrap' Icons
Easily use 'Bootstrap' icons inside 'Shiny' apps and 'R Markdown' documents. More generally, icons can be inserted in any 'htmltools' document through inline 'SVG'.
Last updated 9 months ago
13 stars 2.42 score 6 dependencies 3 dependentsrscontract - Generic implementation of the 'RStudio' connections contract
Provides a generic implementation of the 'RStudio' connection contract to make it easier for database connections, and other type of connections, opened via R packages integrate with the connections pane inside the 'RStudio' interactive development environment (IDE).
Last updated 4 years ago
connections-panerstudio
21 stars 2.39 score 0 dependencies 2 dependents