Package: graphframes 0.1.2

Kevin Kuo

graphframes: Interface for 'GraphFrames'

A 'sparklyr' <https://spark.rstudio.com/> extension that provides an R interface for 'GraphFrames' <https://graphframes.github.io/>. 'GraphFrames' is a package for 'Apache Spark' that provides a DataFrame-based API for working with graphs. Functionality includes motif finding and common graph algorithms, such as PageRank and Breadth-first search.

Authors:Kevin Kuo [aut, cre]

graphframes_0.1.2.tar.gz
graphframes_0.1.2.zip(r-4.5)graphframes_0.1.2.zip(r-4.4)graphframes_0.1.2.zip(r-4.3)
graphframes_0.1.2.tgz(r-4.4-any)graphframes_0.1.2.tgz(r-4.3-any)
graphframes_0.1.2.tar.gz(r-4.5-noble)graphframes_0.1.2.tar.gz(r-4.4-noble)
graphframes_0.1.2.tgz(r-4.4-emscripten)graphframes_0.1.2.tgz(r-4.3-emscripten)
graphframes.pdf |graphframes.html
graphframes/json (API)
NEWS

# Install graphframes in R:
install.packages('graphframes', repos = c('https://rstudio.r-universe.dev', 'https://cloud.r-project.org'))

Peer review:

Bug tracker:https://github.com/rstudio/graphframes/issues

On CRAN:

graphframesgraphspageranksparksparklyr

27 exports 38 stars 2.73 score 40 dependencies

Last updated 5 years agofrom:444ed9d9a04fd11eaf504ba164f6502c25cca91b

Exports:gf_bfsgf_cachegf_chaingf_connected_componentsgf_degreesgf_edge_columnsgf_edgesgf_findgf_friendsgf_graphframegf_grid_ising_modelgf_in_degreesgf_lpagf_out_degreesgf_pagerankgf_persistgf_registergf_sccgf_shortest_pathsgf_stargf_triangle_countgf_tripletsgf_two_blobsgf_unpersistgf_vertex_columnsgf_verticesspark_graphframe

Dependencies:askpassblobclicodetoolsconfigcpp11curlDBIdbplyrdplyrfansiforgegenericsglobalsgluehttrjsonlitelifecyclemagrittrmimeopensslpillarpkgconfigpurrrR6rlangrstudioapisparklyrstringistringrsystibbletidyrtidyselectutf8uuidvctrswithrxml2yaml